| Brand: | Abnova |
| Reference: | H00006666-M06 |
| Product name: | SOX12 monoclonal antibody (M06), clone 2A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX12. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6666 |
| Gene name: | SOX12 |
| Gene alias: | SOX22 |
| Gene description: | SRY (sex determining region Y)-box 12 |
| Genbank accession: | NM_006943 |
| Immunogen: | SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF |
| Protein accession: | NP_008874 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SOX12 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |