Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of SOX12 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SOX12 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006666-A01 |
| Product name: | SOX12 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SOX12. |
| Gene id: | 6666 |
| Gene name: | SOX12 |
| Gene alias: | SOX22 |
| Gene description: | SRY (sex determining region Y)-box 12 |
| Genbank accession: | NM_006943 |
| Immunogen: | SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF |
| Protein accession: | NP_008874 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SOX12 polyclonal antibody (A01), Lot # 051004JC01 Western Blot analysis of SOX12 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |