| Brand: | Abnova |
| Reference: | H00006663-M01 |
| Product name: | SOX10 monoclonal antibody (M01), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX10. |
| Clone: | 1E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6663 |
| Gene name: | SOX10 |
| Gene alias: | DOM|MGC15649|WS2E|WS4 |
| Gene description: | SRY (sex determining region Y)-box 10 |
| Genbank accession: | NM_006941 |
| Immunogen: | SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR |
| Protein accession: | NP_008872 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Histopathological study of the treatment of melasma lesions using a low-fluence Q-switched 1064-nm neodymium:yttrium-aluminium-garnet laser.Kim JE, Chang SE, Yeo UC, Haw S, Kim IH Clin Exp Dermatol. 2013 Mar;38(2):167-71. doi: 10.1111/j.1365-2230.2012.04473.x. |