Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SOX9 monoclonal antibody (M01), clone 2A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SOX9 monoclonal antibody (M01), clone 2A2
| Brand: | Abnova |
| Reference: | H00006662-M01 |
| Product name: | SOX9 monoclonal antibody (M01), clone 2A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX9. |
| Clone: | 2A2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6662 |
| Gene name: | SOX9 |
| Gene alias: | CMD1|CMPD1|SRA1 |
| Gene description: | SRY (sex determining region Y)-box 9 |
| Genbank accession: | NM_000346 |
| Immunogen: | SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP |
| Protein accession: | NP_000337 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M01), clone 2A2. Lane 1: SOX9 transfected lysate(63.639 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Primary cilia function regulates the length of the embryonic trunk axis and urogenital field in mice.Wainwright EN, Svingen T, Ng ET, Wicking C, Koopman P Dev Biol. 2014 Sep 16. pii: S0012-1606(14)00444-8. doi: 10.1016/j.ydbio.2014.08.037. |