Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SOX3 monoclonal antibody (M04), clone 1F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SOX3 monoclonal antibody (M04), clone 1F2
| Brand: | Abnova |
| Reference: | H00006658-M04 |
| Product name: | SOX3 monoclonal antibody (M04), clone 1F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX3. |
| Clone: | 1F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6658 |
| Gene name: | SOX3 |
| Gene alias: | GHDX|MRGH|PHP|PHPX|SOXB |
| Gene description: | SRY (sex determining region Y)-box 3 |
| Genbank accession: | NM_005634 |
| Immunogen: | SOX3 (NP_005625, 375 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNGTVPLTH* |
| Protein accession: | NP_005625 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SOX3 monoclonal antibody (M04), clone 1F2 Western Blot analysis of SOX3 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |