No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,PLA-Ce |
Brand: | Abnova |
Reference: | H00006654-M01 |
Product name: | SOS1 monoclonal antibody (M01), clone 4C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SOS1. |
Clone: | 4C1 |
Isotype: | IgG2a Kappa |
Gene id: | 6654 |
Gene name: | SOS1 |
Gene alias: | GF1|GGF1|GINGF|HGF|NS4 |
Gene description: | son of sevenless homolog 1 (Drosophila) |
Genbank accession: | NM_005633 |
Immunogen: | SOS1 (NP_005624, 313 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK |
Protein accession: | NP_005624 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | S-ELISA,ELISA,PLA-Ce |
Shipping condition: | Dry Ice |