| Brand: | Abnova |
| Reference: | H00006654-M01 |
| Product name: | SOS1 monoclonal antibody (M01), clone 4C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOS1. |
| Clone: | 4C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6654 |
| Gene name: | SOS1 |
| Gene alias: | GF1|GGF1|GINGF|HGF|NS4 |
| Gene description: | son of sevenless homolog 1 (Drosophila) |
| Genbank accession: | NM_005633 |
| Immunogen: | SOS1 (NP_005624, 313 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK |
| Protein accession: | NP_005624 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,PLA-Ce |
| Shipping condition: | Dry Ice |