Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SORL1 monoclonal antibody (M01), clone 3F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SORL1 monoclonal antibody (M01), clone 3F2
| Brand: | Abnova |
| Reference: | H00006653-M01 |
| Product name: | SORL1 monoclonal antibody (M01), clone 3F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SORL1. |
| Clone: | 3F2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6653 |
| Gene name: | SORL1 |
| Gene alias: | C11orf32|FLJ21930|FLJ39258|LR11|LRP9|SORLA|SorLA-1|gp250 |
| Gene description: | sortilin-related receptor, L(DLR class) A repeats-containing |
| Genbank accession: | NM_003105 |
| Immunogen: | SORL1 (NP_003096, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD |
| Protein accession: | NP_003096 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SORL1 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |