No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006653-M01 |
Product name: | SORL1 monoclonal antibody (M01), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SORL1. |
Clone: | 3F2 |
Isotype: | IgG2b Kappa |
Gene id: | 6653 |
Gene name: | SORL1 |
Gene alias: | C11orf32|FLJ21930|FLJ39258|LR11|LRP9|SORLA|SorLA-1|gp250 |
Gene description: | sortilin-related receptor, L(DLR class) A repeats-containing |
Genbank accession: | NM_003105 |
Immunogen: | SORL1 (NP_003096, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD |
Protein accession: | NP_003096 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SORL1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |