Cart 1 Product Products 109,47 € (empty)
No products
To be determined Shipping
109,47 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 109,47 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 109,47 €
Data sheet of SORD monoclonal antibody (M03), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about SORD monoclonal antibody (M03), clone 1C2
| Brand: | Abnova |
| Reference: | H00006652-M03 |
| Product name: | SORD monoclonal antibody (M03), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SORD. |
| Clone: | 1C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6652 |
| Gene name: | SORD |
| Gene alias: | SORD1 |
| Gene description: | sorbitol dehydrogenase |
| Genbank accession: | BC021085 |
| Immunogen: | SORD (AAH21085, 1 a.a. ~ 357 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP |
| Protein accession: | AAH21085 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (64.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SORD expression in transfected 293T cell line by SORD monoclonal antibody (M03), clone 1C2. Lane 1: SORD transfected lysate(38.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |