Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SORD monoclonal antibody (M01), clone 4D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SORD monoclonal antibody (M01), clone 4D3
| Brand: | Abnova |
| Reference: | H00006652-M01 |
| Product name: | SORD monoclonal antibody (M01), clone 4D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SORD. |
| Clone: | 4D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6652 |
| Gene name: | SORD |
| Gene alias: | SORD1 |
| Gene description: | sorbitol dehydrogenase |
| Genbank accession: | NM_003104 |
| Immunogen: | SORD (NP_003095, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR |
| Protein accession: | NP_003095 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | SORD monoclonal antibody (M01), clone 4D3 Western Blot analysis of SORD expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Sorbitol dehydrogenase expression is regulated by androgens in the human prostate.Szabo Z, Hamalainen J, Loikkanen I, Moilanen AM, Hirvikoski P, Vaisanen T, Paavonen TK, Vaarala MH. Oncol Rep. 2010 May;23(5):1233-9. |