Cart 21 Product Products 6 201,58 € (empty)
-
-
-
-
-
1 x Ghrelin...474,00 € -
1 x Phospho-Se...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
6 201,58 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 21 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 201,58 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 201,58 €
Data sheet of SOD3 monoclonal antibody (M01), clone 5C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SOD3 monoclonal antibody (M01), clone 5C3
| Brand: | Abnova |
| Reference: | H00006649-M01 |
| Product name: | SOD3 monoclonal antibody (M01), clone 5C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOD3. |
| Clone: | 5C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6649 |
| Gene name: | SOD3 |
| Gene alias: | EC-SOD|MGC20077 |
| Gene description: | superoxide dismutase 3, extracellular |
| Genbank accession: | BC014418 |
| Immunogen: | SOD3 (AAH14418, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC |
| Protein accession: | AAH14418 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SOD3 is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |