Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SOD2 MaxPab mouse polyclonal antibody (B02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about SOD2 MaxPab mouse polyclonal antibody (B02)
| Brand: | Abnova |
| Reference: | H00006648-B02 |
| Product name: | SOD2 MaxPab mouse polyclonal antibody (B02) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SOD2 protein. |
| Gene id: | 6648 |
| Gene name: | SOD2 |
| Gene alias: | IPO-B|MNSOD|Mn-SOD |
| Gene description: | superoxide dismutase 2, mitochondrial |
| Genbank accession: | NM_001024465 |
| Immunogen: | SOD2 (NP_001019636, 1 a.a. ~ 222 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
| Protein accession: | NP_001019636 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SOD2 expression in transfected 293T cell line (H00006648-T02) by SOD2 MaxPab polyclonal antibody. Lane 1: SOD2 transfected lysate(24.42 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Compartmentalized oxidative stress in dopaminergic cell death induced by pesticides and complex I inhibitors: Distinct roles of superoxide anion and superoxide dismutases.Rodriguez-Rocha H, Garcia-Garcia A, Pickett C, Sumin L, Jones J, Chen H, Webb B, Choi J, Zhou Y, Zimmerman MC, Franco R Free Radic Biol Med. 2013 Apr 19. pii: S0891-5849(13)00161-5. doi: 10.1016/j.freeradbiomed.2013.04.021. |