| Brand: | Abnova |
| Reference: | H00006645-M01 |
| Product name: | SNTB2 monoclonal antibody (M01), clone 3F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNTB2. |
| Clone: | 3F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6645 |
| Gene name: | SNTB2 |
| Gene alias: | D16S2531E|EST25263|SNT2B2|SNT3|SNTL |
| Gene description: | syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2) |
| Genbank accession: | NM_006750 |
| Immunogen: | SNTB2 (NP_006741.1, 116 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV |
| Protein accession: | NP_006741.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SNTB2 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |