No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00006645-M01 |
Product name: | SNTB2 monoclonal antibody (M01), clone 3F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNTB2. |
Clone: | 3F12 |
Isotype: | IgG2a Kappa |
Gene id: | 6645 |
Gene name: | SNTB2 |
Gene alias: | D16S2531E|EST25263|SNT2B2|SNT3|SNTL |
Gene description: | syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2) |
Genbank accession: | NM_006750 |
Immunogen: | SNTB2 (NP_006741.1, 116 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV |
Protein accession: | NP_006741.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SNTB2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |