SNX1 monoclonal antibody (M02), clone 1E3 View larger

SNX1 monoclonal antibody (M02), clone 1E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX1 monoclonal antibody (M02), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SNX1 monoclonal antibody (M02), clone 1E3

Brand: Abnova
Reference: H00006642-M02
Product name: SNX1 monoclonal antibody (M02), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant SNX1.
Clone: 1E3
Isotype: IgG2a Kappa
Gene id: 6642
Gene name: SNX1
Gene alias: HsT17379|MGC8664|SNX1A|Vps5
Gene description: sorting nexin 1
Genbank accession: NM_003099
Immunogen: SNX1 (NP_003090, 166 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVG
Protein accession: NP_003090
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006642-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006642-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SNX1 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNX1 monoclonal antibody (M02), clone 1E3 now

Add to cart