| Brand: | Abnova |
| Reference: | H00006629-M01 |
| Product name: | SNRPB2 monoclonal antibody (M01), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SNRPB2. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6629 |
| Gene name: | SNRPB2 |
| Gene alias: | MGC24807|MGC45309 |
| Gene description: | small nuclear ribonucleoprotein polypeptide B'' |
| Genbank accession: | BC036737 |
| Immunogen: | SNRPB2 (AAH36737, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK |
| Protein accession: | AAH36737 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SNRPB2 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |