| Brand: | Abnova |
| Reference: | H00006628-M01A |
| Product name: | SNRPB monoclonal antibody (M01A), clone 1B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNRPB. |
| Clone: | 1B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6628 |
| Gene name: | SNRPB |
| Gene alias: | COD|SNRPB1|SmB/SmB'|snRNP-B |
| Gene description: | small nuclear ribonucleoprotein polypeptides B and B1 |
| Genbank accession: | NM_003091 |
| Immunogen: | SNRPB (NP_003082, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM |
| Protein accession: | NP_003082 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |