| Brand: | Abnova |
| Reference: | H00006623-M01A |
| Product name: | SNCG monoclonal antibody (M01A), clone 2C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNCG. |
| Clone: | 2C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6623 |
| Gene name: | SNCG |
| Gene alias: | BCSG1|SR |
| Gene description: | synuclein, gamma (breast cancer-specific protein 1) |
| Genbank accession: | BC014098 |
| Immunogen: | SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD |
| Protein accession: | AAH14098 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SNCG monoclonal antibody (M01A), clone 2C3. Western Blot analysis of SNCG expression in human spleen. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |