| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006623-M01 |
| Product name: | SNCG monoclonal antibody (M01), clone 2C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNCG. |
| Clone: | 2C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6623 |
| Gene name: | SNCG |
| Gene alias: | BCSG1|SR |
| Gene description: | synuclein, gamma (breast cancer-specific protein 1) |
| Genbank accession: | BC014098 |
| Immunogen: | SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD |
| Protein accession: | AAH14098 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG monoclonal antibody (M01), clone 2C3. Lane 1: SNCG transfected lysate(13.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Adoptive transfer of immune cells from glaucomatous mice provokes retinal ganglion cell loss in recipients.Gramlich OW, Ding QJ, Zhu W, Cook A, Anderson MG, Kuehn MH. Acta Neuropathol Commun. 2015 Sep 15;3:56 |