Cart 28 Product Products 9 361,26 € (empty)
-
-
-
-
1 x Mos...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MAST205...259,07 € -
No products
To be determined Shipping
9 361,26 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 9 361,26 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 9 361,26 €
Data sheet of SNCA polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about SNCA polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00006622-A02 |
| Product name: | SNCA polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SNCA. |
| Gene id: | 6622 |
| Gene name: | SNCA |
| Gene alias: | MGC110988|NACP|PARK1|PARK4|PD1 |
| Gene description: | synuclein, alpha (non A4 component of amyloid precursor) |
| Genbank accession: | NM_000345 |
| Immunogen: | SNCA (NP_000336, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Protein accession: | NP_000336 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |