No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006622-A01 |
Product name: | SNCA polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant SNCA. |
Gene id: | 6622 |
Gene name: | SNCA |
Gene alias: | MGC110988|NACP|PARK1|PARK4|PD1 |
Gene description: | synuclein, alpha (non A4 component of amyloid precursor) |
Genbank accession: | BC013293 |
Immunogen: | SNCA (AAH13293.1, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Protein accession: | AAH13293.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (41.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |