| Brand: | Abnova |
| Reference: | H00006621-M01 |
| Product name: | SNAPC4 monoclonal antibody (M01), clone 1D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAPC4. |
| Clone: | 1D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6621 |
| Gene name: | SNAPC4 |
| Gene alias: | FLJ13451|PTFalpha|SNAP190 |
| Gene description: | small nuclear RNA activating complex, polypeptide 4, 190kDa |
| Genbank accession: | NM_003086 |
| Immunogen: | SNAPC4 (NP_003077, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN |
| Protein accession: | NP_003077 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SNAPC4 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |