| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006617-B01 |
| Product name: | SNAPC1 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SNAPC1 protein. |
| Gene id: | 6617 |
| Gene name: | SNAPC1 |
| Gene alias: | PTFgamma|SNAP43 |
| Gene description: | small nuclear RNA activating complex, polypeptide 1, 43kDa |
| Genbank accession: | BC019038 |
| Immunogen: | SNAPC1 (AAH19038, 1 a.a. ~ 368 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH |
| Protein accession: | AAH19038 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SNAPC1 expression in transfected 293T cell line (H00006617-T01) by SNAPC1 MaxPab polyclonal antibody. Lane 1: SNAPC1 transfected lysate(40.59 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |