SNAPC1 MaxPab mouse polyclonal antibody (B01) View larger

SNAPC1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAPC1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about SNAPC1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006617-B01
Product name: SNAPC1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SNAPC1 protein.
Gene id: 6617
Gene name: SNAPC1
Gene alias: PTFgamma|SNAP43
Gene description: small nuclear RNA activating complex, polypeptide 1, 43kDa
Genbank accession: BC019038
Immunogen: SNAPC1 (AAH19038, 1 a.a. ~ 368 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH
Protein accession: AAH19038
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006617-B01-13-15-1.jpg
Application image note: Western Blot analysis of SNAPC1 expression in transfected 293T cell line (H00006617-T01) by SNAPC1 MaxPab polyclonal antibody.

Lane 1: SNAPC1 transfected lysate(40.59 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNAPC1 MaxPab mouse polyclonal antibody (B01) now

Add to cart