Cart 77 Product Products 25 734,46 € (empty)
No products
To be determined Shipping
25 734,46 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 77 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 734,46 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 25 734,46 €
Data sheet of SNAP25 monoclonal antibody (M01), clone 4A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SNAP25 monoclonal antibody (M01), clone 4A3
| Brand: | Abnova |
| Reference: | H00006616-M01 |
| Product name: | SNAP25 monoclonal antibody (M01), clone 4A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAP25. |
| Clone: | 4A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6616 |
| Gene name: | SNAP25 |
| Gene alias: | FLJ23079|RIC-4|RIC4|SEC9|SNAP|SNAP-25|bA416N4.2|dJ1068F16.2 |
| Gene description: | synaptosomal-associated protein, 25kDa |
| Genbank accession: | BC010647 |
| Immunogen: | SNAP25 (AAH10647, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS |
| Protein accession: | AAH10647 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SNAP25 expression in transfected 293T cell line by SNAP25 monoclonal antibody (M01), clone 4A3. Lane 1: SNAP25 transfected lysate(23.315 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |