No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,IF-CTC |
| Brand: | Abnova |
| Reference: | H00006615-M10 |
| Product name: | SNAI1 monoclonal antibody (M10), clone 2G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAI1. |
| Clone: | 2G11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6615 |
| Gene name: | SNAI1 |
| Gene alias: | SLUGH2|SNA|SNAH|dJ710H13.1 |
| Gene description: | snail homolog 1 (Drosophila) |
| Genbank accession: | NM_005985 |
| Immunogen: | SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH |
| Protein accession: | NP_005976.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged SNAI1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,IF-CTC |
| Shipping condition: | Dry Ice |
| Publications: | Isolation and characterization of a population of stem-like progenitor cells from an atypical meningioma.Rath P, Miller DC, Litofsky NS, Anthony DC, Feng Q, Franklin C, Pei L, Free A, Liu J, Ren M, Kirk MD, Shi H. Exp Mol Pathol. 2010 Dec 17. [Epub ahead of print] |