| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006613-M06 |
| Product name: | SUMO2 monoclonal antibody (M06), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SUMO2. |
| Clone: | 2H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6613 |
| Gene name: | SUMO2 |
| Gene alias: | HSMT3|MGC117191|SMT3B|SMT3H2 |
| Gene description: | SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) |
| Genbank accession: | BC008450 |
| Immunogen: | SUMO2 (AAH08450, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
| Protein accession: | AAH08450 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SUMO2 expression in transfected 293T cell line by SUMO2 monoclonal antibody (M06), clone 2H8. Lane 1: SUMO2 transfected lysate(10.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |