Cart 85 Product Products 27 951,13 € (empty)
No products
To be determined Shipping
27 951,13 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 85 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 951,13 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 951,13 €
Data sheet of SUMO3 monoclonal antibody (M07), clone 4B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about SUMO3 monoclonal antibody (M07), clone 4B9
| Brand: | Abnova |
| Reference: | H00006612-M07 |
| Product name: | SUMO3 monoclonal antibody (M07), clone 4B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SUMO3. |
| Clone: | 4B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6612 |
| Gene name: | SUMO3 |
| Gene alias: | SMT3A|SMT3H1|SUMO-3 |
| Gene description: | SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) |
| Genbank accession: | NM_006936 |
| Immunogen: | SUMO3 (NP_008867, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
| Protein accession: | NP_008867 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SUMO3 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |