SUMO3 purified MaxPab mouse polyclonal antibody (B01P) View larger

SUMO3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMO3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about SUMO3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006612-B01P
Product name: SUMO3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SUMO3 protein.
Gene id: 6612
Gene name: SUMO3
Gene alias: SMT3A|SMT3H1|SUMO-3
Gene description: SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
Genbank accession: BC008420
Immunogen: SUMO3 (AAH08420, 1 a.a. ~ 103 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Protein accession: AAH08420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006612-B01P-4-1-1-L.jpg
Application image note: Immunofluorescence of purified MaxPab antibody to SUMO3 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUMO3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart