SMO monoclonal antibody (M31), clone 3E5 View larger

SMO monoclonal antibody (M31), clone 3E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMO monoclonal antibody (M31), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SMO monoclonal antibody (M31), clone 3E5

Brand: Abnova
Reference: H00006608-M31
Product name: SMO monoclonal antibody (M31), clone 3E5
Product description: Mouse monoclonal antibody raised against a partial recombinant SMO.
Clone: 3E5
Isotype: IgG2a Kappa
Gene id: 6608
Gene name: SMO
Gene alias: Gx|SMOH
Gene description: smoothened homolog (Drosophila)
Genbank accession: NM_005631
Immunogen: SMO (NP_005622.1, 653 a.a. ~ 787 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Protein accession: NP_005622.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006608-M31-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006608-M31-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SMO is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMO monoclonal antibody (M31), clone 3E5 now

Add to cart