Cart 8 Product Products 2 756,23 € (empty)
No products
To be determined Shipping
2 756,23 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 756,23 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 756,23 €
Data sheet of SMO monoclonal antibody (M01), clone 1D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about SMO monoclonal antibody (M01), clone 1D6
| Brand: | Abnova |
| Reference: | H00006608-M01 |
| Product name: | SMO monoclonal antibody (M01), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMO. |
| Clone: | 1D6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6608 |
| Gene name: | SMO |
| Gene alias: | Gx|SMOH |
| Gene description: | smoothened homolog (Drosophila) |
| Genbank accession: | NM_005631 |
| Immunogen: | SMO (NP_005622, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA |
| Protein accession: | NP_005622 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged SMO is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |