SMN2 MaxPab rabbit polyclonal antibody (D01) View larger

SMN2 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMN2 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIP

More info about SMN2 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00006607-D01
Product name: SMN2 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human SMN2 protein.
Gene id: 6607
Gene name: SMN2
Gene alias: BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene description: survival of motor neuron 2, centromeric
Genbank accession: NM_022875
Immunogen: SMN2 (NP_075013.1, 1 a.a. ~ 282 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Protein accession: NP_075013.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00006607-D01-31-15-1.jpg
Application image note: Immunoprecipitation of SMN2 transfected lysate using anti-SMN2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SMN2 purified MaxPab mouse polyclonal antibody (B01P) (H00006607-B01P).
Applications: IP
Related products: - SMO polyclonal antibody (A01)
- SUMO3 polyclonal antibody (A01)
- SUMO3 MaxPab mouse polyclonal antibody (B01)
- SUMO3 purified MaxPab mouse polyclonal antibody (B01P)
- SUMO2 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy SMN2 MaxPab rabbit polyclonal antibody (D01) now

Add to cart