SMN2 purified MaxPab mouse polyclonal antibody (B01P) View larger

SMN2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMN2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about SMN2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006607-B01P
Product name: SMN2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SMN2 protein.
Gene id: 6607
Gene name: SMN2
Gene alias: BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene description: survival of motor neuron 2, centromeric
Genbank accession: NM_022875.1
Immunogen: SMN2 (NP_075013.1, 1 a.a. ~ 282 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Protein accession: NP_075013.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006607-B01P-2-A0-1.jpg
Application image note: SMN2 MaxPab polyclonal antibody. Western Blot analysis of SMN2 expression in human kidney.
Applications: WB-Ti,IF,WB-Tr
Related products: - SMN2 purified MaxPab mouse polyclonal antibody (B02P)
- SMN2 MaxPab rabbit polyclonal antibody (D01)
- SMO polyclonal antibody (A01)
- SUMO3 polyclonal antibody (A01)
- SUMO3 MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice

Buy SMN2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart