SMN2 polyclonal antibody (A02) View larger

SMN2 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMN2 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about SMN2 polyclonal antibody (A02)

Brand: Abnova
Reference: H00006607-A02
Product name: SMN2 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a full-length recombinant SMN2.
Gene id: 6607
Gene name: SMN2
Gene alias: BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene description: survival of motor neuron 2, centromeric
Genbank accession: BC000908
Immunogen: SMN2 (AAH00908, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Protein accession: AAH00908
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006607-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006607-A02-2-A5-1.jpg
Application image note: SMN2 polyclonal antibody (A01). Western Blot analysis of SMN2 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Related products: - SMN2 MaxPab mouse polyclonal antibody (B01)
- SMN2 purified MaxPab mouse polyclonal antibody (B01P)
- SMN2 purified MaxPab mouse polyclonal antibody (B02P)
- SMN2 MaxPab rabbit polyclonal antibody (D01)
- SMO polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy SMN2 polyclonal antibody (A02) now

Add to cart