Login to display prices
Login to display prices
SMN2 polyclonal antibody (A02) View larger

SMN2 polyclonal antibody (A02)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMN2 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about SMN2 polyclonal antibody (A02)

Reference: H00006607-A02
Product name: SMN2 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a full-length recombinant SMN2.
Gene id: 6607
Gene name: SMN2
Gene alias: BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene description: survival of motor neuron 2, centromeric
Genbank accession: BC000908
Immunogen: SMN2 (AAH00908, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Protein accession: AAH00908
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: