Login to display prices
Login to display prices
SMN2 polyclonal antibody (A01) View larger

SMN2 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMN2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMN2 polyclonal antibody (A01)

Reference: H00006607-A01
Product name: SMN2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMN2.
Gene id: 6607
Gene name: SMN2
Gene alias: BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene description: survival of motor neuron 2, centromeric
Genbank accession: NM_017411
Immunogen: SMN2 (NP_059107, 191 a.a. ~ 294 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
Protein accession: NP_059107
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: