Login to display prices
Login to display prices
SMARCE1 monoclonal antibody (M01), clone 6G11 View larger

SMARCE1 monoclonal antibody (M01), clone 6G11

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCE1 monoclonal antibody (M01), clone 6G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re,IP

More info about SMARCE1 monoclonal antibody (M01), clone 6G11

Reference: H00006605-M01
Product name: SMARCE1 monoclonal antibody (M01), clone 6G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCE1.
Clone: 6G11
Isotype: IgG1 Kappa
Gene id: 6605
Gene name: SMARCE1
Gene alias: BAF57
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Genbank accession: NM_003079
Immunogen: SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Protein accession: NP_003070
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: