SMARCE1 polyclonal antibody (A01) View larger

SMARCE1 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCE1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCE1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006605-A01
Product name: SMARCE1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCE1.
Gene id: 6605
Gene name: SMARCE1
Gene alias: BAF57
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Genbank accession: NM_003079
Immunogen: SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Protein accession: NP_003070
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006605-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.59 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006605-A01-1-75-1.jpg
Application image note: SMARCE1 polyclonal antibody (A01), Lot # 060529JCS1. Western Blot analysis of SMARCE1 expression in Daoy.
Applications: WB-Ce,ELISA,WB-Re
Related products: - SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)
- SMARCE1 purified MaxPab rabbit polyclonal antibody (D01P)
- SMN2 polyclonal antibody (A01)
- SMN2 polyclonal antibody (A02)
- SMN2 MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice

Buy SMARCE1 polyclonal antibody (A01) now

Add to cart