Login to display prices
Login to display prices
SMARCE1 polyclonal antibody (A01) View larger

SMARCE1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCE1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCE1 polyclonal antibody (A01)

Reference: H00006605-A01
Product name: SMARCE1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCE1.
Gene id: 6605
Gene name: SMARCE1
Gene alias: BAF57
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Genbank accession: NM_003079
Immunogen: SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Protein accession: NP_003070
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: