Login to display prices
Login to display prices
SMARCD3 monoclonal antibody (M03A), clone 5G4 View larger

SMARCD3 monoclonal antibody (M03A), clone 5G4

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD3 monoclonal antibody (M03A), clone 5G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCD3 monoclonal antibody (M03A), clone 5G4

Reference: H00006604-M03A
Product name: SMARCD3 monoclonal antibody (M03A), clone 5G4
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Clone: 5G4
Isotype: IgG2a Kappa
Gene id: 6604
Gene name: SMARCD3
Gene alias: BAF60C|CRACD3|MGC111010|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Genbank accession: NM_001003801
Immunogen: SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Protein accession: NP_001003801
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: