No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006604-M03A |
Product name: | SMARCD3 monoclonal antibody (M03A), clone 5G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMARCD3. |
Clone: | 5G4 |
Isotype: | IgG2a Kappa |
Gene id: | 6604 |
Gene name: | SMARCD3 |
Gene alias: | BAF60C|CRACD3|MGC111010|Rsc6p |
Gene description: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 |
Genbank accession: | NM_001003801 |
Immunogen: | SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT |
Protein accession: | NP_001003801 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SMARCD3 monoclonal antibody (M03A), clone 5G4 Western Blot analysis of SMARCD3 expression in K-562( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |