View larger

SMARCD3 monoclonal antibody (M01A), clone 1G6

Reference:

Condition: New product

Data sheet of SMARCD3 monoclonal antibody (M01A), clone 1G6

Brand:	Abnova
Reference:	H00006604-M01A
Product name:	SMARCD3 monoclonal antibody (M01A), clone 1G6
Product description:	Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Clone:	1G6
Isotype:	IgG2a Kappa
Gene id:	6604
Gene name:	SMARCD3
Gene alias:	BAF60C\|CRACD3\|MGC111010\|Rsc6p
Gene description:	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Genbank accession:	NM_001003801
Immunogen:	SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Protein accession:	NP_001003801
Storage buffer:	In ascites fluid
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.63 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	SMARCD3 monoclonal antibody (M01A), clone 1G6 Western Blot analysis of SMARCD3 expression in K-562 ( Cat # L009V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice