Login to display prices
Login to display prices
SMARCD3 polyclonal antibody (A01) View larger

SMARCD3 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMARCD3 polyclonal antibody (A01)

Reference: H00006604-A01
Product name: SMARCD3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCD3.
Gene id: 6604
Gene name: SMARCD3
Gene alias: BAF60C|CRACD3|MGC111010|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Genbank accession: NM_001003801
Immunogen: SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Protein accession: NP_001003801
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: