SMARCD3 polyclonal antibody (A01) View larger

SMARCD3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMARCD3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006604-A01
Product name: SMARCD3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCD3.
Gene id: 6604
Gene name: SMARCD3
Gene alias: BAF60C|CRACD3|MGC111010|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Genbank accession: NM_001003801
Immunogen: SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Protein accession: NP_001003801
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006604-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - SMARCE1 polyclonal antibody (A01)
- SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)
- SMARCE1 purified MaxPab rabbit polyclonal antibody (D01P)
- SMN2 polyclonal antibody (A01)
- SMN2 polyclonal antibody (A02)
Shipping condition: Dry Ice

Buy SMARCD3 polyclonal antibody (A01) now

Add to cart