Login to display prices
Login to display prices
SMARCD2 (Human) Recombinant Protein (Q01) View larger

SMARCD2 (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SMARCD2 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00006603-Q01
Product name: SMARCD2 (Human) Recombinant Protein (Q01)
Product description: Human SMARCD2 partial ORF ( NP_003068, 398 a.a. - 474 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6603
Gene name: SMARCD2
Gene alias: BAF60B|CRACD2|PRO2451|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Genbank accession: NM_003077
Immunogen sequence/protein sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Protein accession: NP_003068
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006603-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - SMARCD3 (Human) Recombinant Protein (P01)
- SMARCD3 (Human) Recombinant Protein (Q01)
- SMARCE1 (Human) Recombinant Protein (P01)
- SMARCE1 (Human) Recombinant Protein (Q01)
- SMN2 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice