Login to display prices
Login to display prices
SMARCD2 monoclonal antibody (M01), clone 2F7 View larger

SMARCD2 monoclonal antibody (M01), clone 2F7

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD2 monoclonal antibody (M01), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about SMARCD2 monoclonal antibody (M01), clone 2F7

Reference: H00006603-M01
Product name: SMARCD2 monoclonal antibody (M01), clone 2F7
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
Clone: 2F7
Isotype: IgG2a Kappa
Gene id: 6603
Gene name: SMARCD2
Gene alias: BAF60B|CRACD2|PRO2451|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Genbank accession: NM_003077
Immunogen: SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Protein accession: NP_003068
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: