SMARCC1 polyclonal antibody (A01) View larger

SMARCC1 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCC1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCC1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006599-A01
Product name: SMARCC1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCC1.
Gene id: 6599
Gene name: SMARCC1
Gene alias: BAF155|CRACC1|Rsc8|SRG3|SWI3
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
Genbank accession: NM_003074
Immunogen: SMARCC1 (NP_003065, 338 a.a. ~ 437 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL
Protein accession: NP_003065
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006599-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006599-A01-1-34-1.jpg
Application image note: SMARCC1 polyclonal antibody (A01), Lot # 051012JC01 Western Blot analysis of SMARCC1 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Related products: - SMARCD3 polyclonal antibody (A01)
- SMARCE1 polyclonal antibody (A01)
- SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)
- SMARCE1 purified MaxPab rabbit polyclonal antibody (D01P)
- SMN2 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy SMARCC1 polyclonal antibody (A01) now

Add to cart