SMARCB1 monoclonal antibody (M13), clone 3B9 View larger

SMARCB1 monoclonal antibody (M13), clone 3B9

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 monoclonal antibody (M13), clone 3B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about SMARCB1 monoclonal antibody (M13), clone 3B9

Brand: Abnova
Reference: H00006598-M13
Product name: SMARCB1 monoclonal antibody (M13), clone 3B9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Clone: 3B9
Isotype: IgG2b Kappa
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_002931
Immunogen: SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Protein accession: NP_002922
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006598-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.80 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006598-M13-13-15-1.jpg
Application image note: Western Blot analysis of SMARCB1 expression in transfected 293T cell line by SMARCB1 monoclonal antibody (M13), clone 3B9.

Lane 1: SMARCB1 transfected lysate(44.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Related products: - SMARCB1 monoclonal antibody (M14), clone 2H1
- SMARCD2 monoclonal antibody (M01), clone 2F7
- SMARCD2 monoclonal antibody (M02), clone 2B2
- SMARCD2 monoclonal antibody (M03), clone 2C2
- SMARCD3 monoclonal antibody (M01), clone 1G6
Shipping condition: Dry Ice

Buy SMARCB1 monoclonal antibody (M13), clone 3B9 now

Add to cart