Login to display prices
Login to display prices
SMARCB1 monoclonal antibody (M13), clone 3B9 View larger

SMARCB1 monoclonal antibody (M13), clone 3B9

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 monoclonal antibody (M13), clone 3B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about SMARCB1 monoclonal antibody (M13), clone 3B9

Reference: H00006598-M13
Product name: SMARCB1 monoclonal antibody (M13), clone 3B9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Clone: 3B9
Isotype: IgG2b Kappa
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_002931
Immunogen: SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Protein accession: NP_002922
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: