No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006598-M13 |
| Product name: | SMARCB1 monoclonal antibody (M13), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SMARCB1. |
| Clone: | 3B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6598 |
| Gene name: | SMARCB1 |
| Gene alias: | BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS |
| Gene description: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Genbank accession: | NM_002931 |
| Immunogen: | SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE |
| Protein accession: | NP_002922 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.80 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SMARCB1 expression in transfected 293T cell line by SMARCB1 monoclonal antibody (M13), clone 3B9. Lane 1: SMARCB1 transfected lysate(44.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |