View larger

SMARCB1 monoclonal antibody (M12), clone 2D10

Reference:

Condition: New product

Data sheet of SMARCB1 monoclonal antibody (M12), clone 2D10

Brand:	Abnova
Reference:	H00006598-M12
Product name:	SMARCB1 monoclonal antibody (M12), clone 2D10
Product description:	Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Clone:	2D10
Isotype:	IgG2b Kappa
Gene id:	6598
Gene name:	SMARCB1
Gene alias:	BAF47\|INI1\|RDT\|SNF5\|SNF5L1\|Sfh1p\|Snr1\|hSNFS
Gene description:	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession:	NM_002931
Immunogen:	SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Protein accession:	NP_002922
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (34.80 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	SMARCB1 monoclonal antibody (M12), clone 2D10. Western Blot analysis of SMARCB1 expression in C32 ( Cat # L002V1 ).
Applications:	WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition:	Dry Ice