SMARCB1 monoclonal antibody (M06), clone 2A3 View larger

SMARCB1 monoclonal antibody (M06), clone 2A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 monoclonal antibody (M06), clone 2A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCB1 monoclonal antibody (M06), clone 2A3

Brand: Abnova
Reference: H00006598-M06
Product name: SMARCB1 monoclonal antibody (M06), clone 2A3
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCB1.
Clone: 2A3
Isotype: IgG2b Kappa
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_003073
Immunogen: SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Protein accession: NP_003064
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006598-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006598-M06-1-25-1.jpg
Application image note: SMARCB1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of SMARCB1 expression in Hela S3 NE(Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMARCB1 monoclonal antibody (M06), clone 2A3 now

Add to cart