No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00006598-M03 |
| Product name: | SMARCB1 monoclonal antibody (M03), clone 3C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMARCB1. |
| Clone: | 3C4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6598 |
| Gene name: | SMARCB1 |
| Gene alias: | BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS |
| Gene description: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Genbank accession: | NM_003073 |
| Immunogen: | SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA |
| Protein accession: | NP_003064 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | SMARCB1 monoclonal antibody (M03), clone 3C4 Western Blot analysis of SMARCB1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |