Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006598-A01 |
Product name: | SMARCB1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SMARCB1. |
Gene id: | 6598 |
Gene name: | SMARCB1 |
Gene alias: | BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS |
Gene description: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
Genbank accession: | NM_003073 |
Immunogen: | SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA |
Protein accession: | NP_003064 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Related products: | - SMARCB1 purified MaxPab mouse polyclonal antibody (B01P) - SMARCB1 MaxPab rabbit polyclonal antibody (D01) - SMARCB1 purified MaxPab rabbit polyclonal antibody (D01P) - SMARCB1 purified MaxPab rabbit polyclonal antibody (D03P) - SMARCC1 polyclonal antibody (A01) |
Shipping condition: | Dry Ice |