Login to display prices
Login to display prices
SMARCB1 polyclonal antibody (A01) View larger

SMARCB1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMARCB1 polyclonal antibody (A01)

Reference: H00006598-A01
Product name: SMARCB1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCB1.
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_003073
Immunogen: SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Protein accession: NP_003064
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: