SMARCB1 polyclonal antibody (A01) View larger

SMARCB1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMARCB1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006598-A01
Product name: SMARCB1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCB1.
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_003073
Immunogen: SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Protein accession: NP_003064
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006598-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)
- SMARCB1 MaxPab rabbit polyclonal antibody (D01)
- SMARCB1 purified MaxPab rabbit polyclonal antibody (D01P)
- SMARCB1 purified MaxPab rabbit polyclonal antibody (D03P)
- SMARCC1 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy SMARCB1 polyclonal antibody (A01) now

Add to cart