SMARCA4 (Human) Recombinant Protein (Q01) View larger

SMARCA4 (Human) Recombinant Protein (Q01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCA4 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SMARCA4 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00006597-Q01
Product name: SMARCA4 (Human) Recombinant Protein (Q01)
Product description: Human SMARCA4 partial ORF ( NP_003063, 1451 a.a. - 1550 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6597
Gene name: SMARCA4
Gene alias: BAF190|BRG1|FLJ39786|SNF2|SNF2-BETA|SNF2L4|SNF2LB|SWI2|hSNF2b
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Genbank accession: NM_003072
Immunogen sequence/protein sequence: LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS
Protein accession: NP_003063
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006597-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - SMARCB1 (Human) Recombinant Protein (P01)
- SMARCB1 (Human) Recombinant Protein (Q01)
- SMARCC1 (Human) Recombinant Protein (Q01)
- SMARCC2 (Human) Recombinant Protein (P01)
- SMARCD1 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy SMARCA4 (Human) Recombinant Protein (Q01) now

Add to cart