Login to display prices
Login to display prices
SMARCA4 polyclonal antibody (A01) View larger

SMARCA4 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCA4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA

More info about SMARCA4 polyclonal antibody (A01)

Reference: H00006597-A01
Product name: SMARCA4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCA4.
Gene id: 6597
Gene name: SMARCA4
Gene alias: BAF190|BRG1|FLJ39786|SNF2|SNF2-BETA|SNF2L4|SNF2LB|SWI2|hSNF2b
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Genbank accession: NM_003072
Immunogen: SMARCA4 (NP_003063, 1451 a.a. ~ 1550 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS
Protein accession: NP_003063
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: