Login to display prices
Login to display prices
SMARCA3 (Human) Recombinant Protein (Q01) View larger

SMARCA3 (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCA3 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SMARCA3 (Human) Recombinant Protein (Q01)

Reference: H00006596-Q01
Product name: SMARCA3 (Human) Recombinant Protein (Q01)
Product description: Human SMARCA3 partial ORF ( NP_003062, 932 a.a. - 1009 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6596
Gene name: HLTF
Gene alias: HIP116|HIP116A|HLTF1|RNF80|SMARCA3|SNF2L3|ZBU1
Gene description: helicase-like transcription factor
Genbank accession: NM_003071
Immunogen sequence/protein sequence: PAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
Protein accession: NP_003062
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: