SMARCA3 polyclonal antibody (A01) View larger

SMARCA3 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCA3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SMARCA3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006596-A01
Product name: SMARCA3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCA3.
Gene id: 6596
Gene name: HLTF
Gene alias: HIP116|HIP116A|HLTF1|RNF80|SMARCA3|SNF2L3|ZBU1
Gene description: helicase-like transcription factor
Genbank accession: NM_003071
Immunogen: SMARCA3 (NP_003062, 932 a.a. ~ 1009 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
Protein accession: NP_003062
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006596-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.69 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - SMARCA4 polyclonal antibody (A01)
- SMARCB1 polyclonal antibody (A01)
- SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)
- SMARCB1 MaxPab rabbit polyclonal antibody (D01)
- SMARCB1 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy SMARCA3 polyclonal antibody (A01) now

Add to cart