View larger

SLPI (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of SLPI (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00006590-Q01
Product name:	SLPI (Human) Recombinant Protein (Q01)
Product description:	Human SLPI partial ORF ( NP_003055, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	6590
Gene name:	SLPI
Gene alias:	ALK1\|ALP\|BLPI\|HUSI\|HUSI-I\|MPI\|WAP4\|WFDC4
Gene description:	secretory leukocyte peptidase inhibitor
Genbank accession:	NM_003064
Immunogen sequence/protein sequence:	GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Protein accession:	NP_003055
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Activated microglia enhance neurogenesis via trypsinogen secretion.Nikolakopoulou AM, Dutta R, Chen Z, Miller RH, Trapp BD Proc Natl Acad Sci U S A. 2013 May 21;110(21):8714-9. doi: 10.1073/pnas.1218856110. Epub 2013 May 6.